PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008226496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 355aa    MW: 39491.2 Da    PI: 7.5686
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008226496.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1791.2e-55181461129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL kkv +++++  ++i+evd++k+ePw+Lp k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s+
  XP_008226496.1  18 LPPGFRFHPTDEELITYYLLKKVLDSSFTG-RAIAEVDLNKCEPWELPDKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSS 111
                     79*************************999.89***************99999****************************************97 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + +lvg+kktLvfy+grapkgek++Wvmheyrle
  XP_008226496.1 112 kTCALVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 146
                     45567****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-6316170IPR003441NAC domain
PROSITE profilePS5100560.10718170IPR003441NAC domain
PfamPF023658.5E-2919145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MDIMSFTGHF DHGSDTHLPP GFRFHPTDEE LITYYLLKKV LDSSFTGRAI AEVDLNKCEP  60
WELPDKAKMG EKEWYFFSLR DRKYPTGLRT NRATEAGYWK ATGKDREIYS SKTCALVGMK  120
KTLVFYRGRA PKGEKSNWVM HEYRLEGKFA YHYLSRSSKD EWVISRVFQK SSGSTTNGPG  180
SKKTRMSNGS TSSISLYPEP SSPSSVSLPP LLDSSPYQNM NTAGLTDRDS CSYDSPIPKE  240
HVSCFSTNPN SGFNLSSSCF DLAHAQPPPQ PGFGGVSAFP SLRSLQENLQ LPFFFSPMSG  300
HQPVHVGSSG GSTIDLGGLS SAGNWPPPPP HQEEPRTVGP TELDCMWTYY KTECL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-521817417169NO APICAL MERISTEM PROTEIN
1ut4_B7e-521817417169NO APICAL MERISTEM PROTEIN
1ut7_A7e-521817417169NO APICAL MERISTEM PROTEIN
1ut7_B7e-521817417169NO APICAL MERISTEM PROTEIN
4dul_A7e-521817417169NAC domain-containing protein 19
4dul_B7e-521817417169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008226496.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2-like
SwissprotO040171e-120NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLM5X6640.0M5X664_PRUPE; Uncharacterized protein
STRINGGLYMA13G34950.11e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36893463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-116NAC family protein